PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cagra.3392s0001.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family G2-like
Protein Properties Length: 362aa    MW: 40401 Da    PI: 8.2937
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cagra.3392s0001.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like102.72.3e-32226281156
              G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                          k+r++W+peLH+rF++a++qLGGs++AtPk+i++lmkv+gLt+++vkSHLQkYRl+
  Cagra.3392s0001.1.p 226 KQRRCWSPELHRRFLHALQQLGGSHVATPKQIRDLMKVDGLTNDEVKSHLQKYRLH 281
                          79****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.288223283IPR017930Myb domain
Gene3DG3DSA:1.10.10.609.9E-29224284IPR009057Homeodomain-like
SuperFamilySSF466894.61E-18224284IPR009057Homeodomain-like
TIGRFAMsTIGR015576.8E-27226281IPR006447Myb domain, plants
PfamPF002492.6E-7228279IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 362 aa     Download sequence    Send to blast
MLKSGAMDYT TNMKRCHDYV EALEQEQKKI QVFQRELPLC LELVTQAIES CRKELSESSS  60
MSEHARSQSE CSERTTSECG DAAPVFEEFI PIKWTSSSSD ANDKDHVADL DESIKTNSDN  120
NAGGDKKKSD WLRSVQLWNQ SSPDPQPKDD QVIINKKAAV IEVKRNNAGA FQPFQKNKPN  180
NKANYNDDSL IKAITPTPTT TSSSTAETVG GKNEFEQLKQ SPSNRKQRRC WSPELHRRFL  240
HALQQLGGSH VATPKQIRDL MKVDGLTNDE VKSHLQKYRL HTRRPATPVS TNVGENTQQR  300
QFMVVEGIWV PSSHDATNTR VYAPVATQPQ QPSPSGERSS MRCKSPATSS STHTPHLLPL  360
S*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00160DAPTransfer from AT1G25550Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006305123.10.0hypothetical protein CARUB_v10009492mg
TrEMBLR0GQJ30.0R0GQJ3_9BRAS; Uncharacterized protein
STRINGAT1G25550.11e-172(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM34912863
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G25550.11e-159G2-like family protein